PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009126474.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family ARF
Protein Properties Length: 1100aa    MW: 121236 Da    PI: 6.832
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009126474.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.64.9e-23127228199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++p++ ae++      +++++++ +l+ +d + ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F +  + +
  XP_009126474.1 127 FCKTLTASDTSTHGGFSVPRRAAEKIfpaldfSMQPPCQ-ELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFVSNKRLFAGDSVLFIR--DGK 218
                     99*****************************98888885.9************************************************5..467 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     ++l+++++r+
  XP_009126474.1 219 AQLLLGIRRA 228
                     8889999997 PP

2Auxin_resp116.13.2e-38253335183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     aaha +++s+F+++YnPra+++eFvv+++k+ ka++ +vs+GmRf+m fete++  rr++Gtv+g+sdldpvrW+ S+Wr+L+
  XP_009126474.1 253 AAHANANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKSSQWRNLQ 335
                     799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-42117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.6E-41121242IPR015300DNA-binding pseudobarrel domain
CDDcd100177.34E-20126227No hitNo description
SMARTSM010192.2E-22127229IPR003340B3 DNA binding domain
PfamPF023622.7E-21127228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.196127229IPR003340B3 DNA binding domain
PfamPF065072.5E-33253335IPR010525Auxin response factor
PfamPF023091.8E-99711059IPR033389AUX/IAA domain
PROSITE profilePS5174526.9569731066IPR000270PB1 domain
SuperFamilySSF542779.81E-99861051No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1100 aa     Download sequence    Send to blast
MKAPSSNGVS PNPVEGDRRN INSELWHACA GPLISLPPAG SLVVYFPQGH SEQVAASMQK  60
QTDFIPSYPN LPSKLICMLQ NVTLNADPET DEVYAQMTLQ PVNKYDRDAL LASDMGLKLN  120
RQPNEFFCKT LTASDTSTHG GFSVPRRAAE KIFPALDFSM QPPCQELVAK DIHDNTWTFR  180
HIYRGQPKRH LLTTGWSVFV SNKRLFAGDS VLFIRDGKAQ LLLGIRRANR QQPALSSSVI  240
SSDSMHIGVL AAAAHANANN SPFTIFYNPR AAPAEFVVPL AKYTKAMYAQ VSLGMRFRMI  300
FETEECGVRR YMGTVTGISD LDPVRWKSSQ WRNLQIGWDE SAAGDRPSRV SVWDIEPVLT  360
PFYICPPPFF RPRFAGQPGM PDDETDMESA LKRAMPWLDN GLEMKDSSSS IFPGLSLVQW  420
MSMQQQNGQL PSSAAAAQSG FFPSMLPPAT GMHNNLGGTD DPSKLLSFQT PPGGISSANL  480
QFNKPNPQAS MSQLPQPPTT LSQQQQLQQL LHSSLNHQQQ QSQPQQQQTL QQQHHQPLHQ  540
QTQQLQQQQQ QLQSHPHPQP QSQSQPQQLQ PHQLQQFQLP QNQPYNSQQA AQQHQAQQAS  600
MHHLQPPVVS VSMASSVIVP PSSSLNQNCQ QQQQQSTQLQ HTHRHLGAST SQSNVVETSK  660
SSSSNPMSIP PHDTQFPRQL EQQQPPVLVN GPNQQHKAQQ THQQMFQQSL LEQPHLQFQL  720
LQRLQQQQQQ FLMPGSSSLQ SQLLHQQLQQ PPPQMLVSRP QDKQNPLVGG GGVKAYSGIT  780
DGGDAPSSST SPSTNNCQIS SSTFLNRTQS GPPTLMPDAA VDISGSLVQD LYSKSDMRLK  840
HELAGPQKSK ASLTDHHHQL EASASGTSFL APTFGLDSDS RNSLLGGGAN VDNGFVPDTL  900
LSRGYDSQKD LQNMLSNYGG VTNDIGTEMS TSAIRTQSFG IPNVPAISND VAVNDAGGVL  960
GGGLWPTQTQ RMRTYTKVQK RGSVGRSIDV NRYRGYDELR HDLARMFGIE GQLEDPQTSD  1020
WKLVYVDHEN DILLVGDDPW EEFVNCVQSI KILSSAEVQQ MSLDGNFAGV PVTNQACSGG  1080
DSGNAWRGHY DDNSATSFNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1672135651388Auxin response factor 5
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.181521e-151leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794700.0JN979470.1 Brassica rapa subsp. pekinensis auxin response factor 7-2 (ARF7-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009126474.10.0PREDICTED: auxin response factor 7-like isoform X1
TrEMBLH9B4D10.0H9B4D1_BRARP; Auxin response factor
STRINGBra020125.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20730.20.0ARF family protein